PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof016952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 179aa    MW: 19384.4 Da    PI: 10.6336
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-111277PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-1494138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
        Sof016952  94 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 138
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.102.6E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.19987143IPR017930Myb domain
SuperFamilySSF466899.72E-1889144IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-2090142IPR006447Myb domain, plants
SMARTSM007171.0E-1091141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-1291137IPR009057Homeodomain-like
PfamPF002491.9E-1194138IPR001005SANT/Myb domain
CDDcd001678.12E-1094139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKIFGVRL TDGSAIRKSA SMGNLSLLSA GSTSGGASPA  60
DGPDLADGGA GGYASDDFVQ GSSSASRERK KGVPWTEEEH RRFLLGLQKL GKGDWRGISR  120
NFVVSRTPTQ VASHAQKYFI RQSNMSRRKR RSSLFDMVPD ESMDLPPLPG SQEPETSVX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.79754e-50bud| callus| crown| inflorescence| leaf| meristem| root| seed
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464930.11e-129hypothetical protein SORBIDRAFT_01g029020
SwissprotQ2V9B06e-36MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0C6WCR81e-129A0A0C6WCR8_9POAL; ScMYB41 protein
STRINGSb01g029020.11e-128(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-73MYB_related family protein